Zinc Finger and BTB Domain Containing 6 (ZBTB6) (Middle Region) antibody

Details for Product No. ABIN406780
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms A830092L04Rik, ZID, Zfp482, Znf482, ZNF482
Epitope
Middle Region
(4), (4), (3), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Human, Rat (Rattus)
(35), (23), (14), (2), (1)
Host
Rabbit
(32), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (15), (10), (5), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406780
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB6
Sequence ESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICILH VESISTAGVE
Cross-Reactivity Cow (Bovine), Human, Rat (Rattus)
Predicted Reactivity Horse : 100 %, Human : 100 %, Pig : 80 %, Bovine : 70 %, Rat : 70 %
Characteristics Antigen Size: 424 amino acids
Purification Affinity Purified
Alternative Name ZBTB6
Background ZBTB6 Contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 48 kDa
NCBI Accession NM_006626, NP_006617
UniProt Q15916
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 424 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 6 (ZBTB6) (Middle Region) antibody WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (32), (4)
Reactivities (35), (23), (14), (2), (1)
Applications (26), (15), (10), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (3), (2), (2), (1), (1)
back to top