ABI2 antibody (Abl-Interactor 2)

Details for Product anti-ABI2 Antibody No. ABIN4277305, Supplier: Log in to see
Antigen
  • ABI-2
  • ABI2B
  • AIP-1
  • AblBP3
  • SSH3BP2
  • argBPIA
  • argBPIB
  • 8430425M24Rik
  • AI839867
  • C130078H13
  • abl-interactor 2
  • ABI2
  • abi2
  • Abi2
Reactivity
Human
42
21
11
3
3
2
2
2
2
1
1
1
1
Host
Rabbit
38
4
Clonality
Polyclonal
Conjugate
This ABI2 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
41
21
15
11
3
2
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Isotype IgG
Purification Immunogen affinity purified
Alternative Name ABI2 (ABI2 Antibody Abstract)
Background Gene Symbol: ABI2
Gene ID 10152
Research Area Cancer
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-ABI2 antibody (Abl-Interactor 2) (ABIN4277305) Immunohistochemistry: ABI2 Antibody [NBP2-49637] - Staining of human cerebellum shows...
Western Blotting (WB) image for anti-ABI2 antibody (Abl-Interactor 2) (ABIN4277305) Western Blot: ABI2 Antibody [NBP2-49637] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...