Angiotensin II Receptor-Associated Protein (AGTRAP) antibody

Details for Product No. ABIN4278739, Supplier: Log in to see
Antigen
  • AGTRAP
  • DKFZp469M235
  • LOC100223570
  • ATRAP
  • 3300002E14Rik
  • AT1R
  • Atrap
  • D4Wsu124e
  • angiotensin II receptor-associated protein
  • angiotensin II, type I receptor-associated protein
  • AGTRAP
  • LOC100223570
  • Agtrap
Reactivity
Human
48
8
8
Host
Rabbit
38
10
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
33
30
11
4
3
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name AGTRAP (AGTRAP Antibody Abstract)
Background Gene Symbol: AGTRAP
Gene ID 57085
UniProt Q6RW13
Research Area Cardiovascular
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunocytochemistry/Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunohistochemistry: AGTRAP Antibody [NBP1-91654] - Lane 1: Marker [kDa] 250, 130, 9...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidne...
Did you look for something else?