BBS9 antibody (Bardet-Biedl Syndrome 9)

Details for Product anti-BBS9 Antibody No. ABIN4283230, Supplier: Log in to see
Antigen
  • b1
  • B1
  • C18
  • D1
  • PTHB1
  • RGD1308472
  • E130103I17Rik
  • Bardet-Biedl syndrome 9
  • bardet-biedl syndrome 9
  • Bardet-Biedl syndrome 9 (human)
  • BBS9
  • bbs9
  • Bbs9
Alternatives
anti-Human BBS9 antibody for Western Blotting
Reactivity
Human
37
18
18
2
2
2
2
2
1
1
Host
Rabbit
37
Clonality
Polyclonal
Conjugate
This BBS9 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
25
15
13
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name BBS9 (BBS9 Antibody Abstract)
Background Gene Symbol: BBS9
Gene ID 27241
Pathways Hedgehog Signaling
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Bardet-Biedl Syndrome 9 (BBS9) antibody (ABIN4283230) Immunocytochemistry/Immunofluorescence: BBS9 Antibody [NBP1-88927] Staining of human ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bardet-Biedl Syndrome 9 (BBS9) antibody (ABIN4283230) Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebel...
Product cited in: Chamling, Seo, Searby, Kim, Slusarski, Sheffield: "The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome." in: PLoS genetics, Vol. 10, Issue 2, pp. e1004083, 2014 (PubMed).

Zhang, Seo, Bhattarai, Bugge, Searby, Zhang, Drack, Stone, Sheffield: "BBS mutations modify phenotypic expression of CEP290-related ciliopathies." in: Human molecular genetics, Vol. 23, Issue 1, pp. 40-51, 2013 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunocytochemistry,Western Blotting,Immunofluorescence

Humbert, Weihbrecht, Searby, Li, Pope, Sheffield, Seo: "ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 109, Issue 48, pp. 19691-6, 2012 (PubMed).

Did you look for something else?