BICC1 antibody (Bicaudal C Homolog 1 (Drosophila))

Details for Product anti-BICC1 Antibody No. ABIN4284604, Supplier: Log in to see
Antigen
  • bicc1
  • xBic-C
  • x-Bic-C
  • Bicaudal-C
  • BICC
  • CYSRD
  • Bic-C
  • bpk
  • jcpk
  • bicaudal C homolog 1 (Drosophila)
  • bicaudal C homolog 1b (Drosophila)
  • bicaudal C homolog 1
  • BICC1
  • bicc1b
  • bicc1
  • Bicc1
Reactivity
Human
51
6
4
3
2
2
2
2
2
1
1
Host
Rabbit
28
23
Clonality
Polyclonal
Conjugate
This BICC1 antibody is un-conjugated
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
29
9
3
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name BICC1 (BICC1 Antibody Abstract)
Background Gene Symbol: BICC1
Gene ID 80114
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-BICC1 antibody (Bicaudal C Homolog 1 (Drosophila)) (ABIN4284604) Immunocytochemistry/Immunofluorescence: BICC1 Antibody [NBP1-94171] - Staining of hum...
Immunohistochemistry (IHC) image for anti-BICC1 antibody (Bicaudal C Homolog 1 (Drosophila)) (ABIN4284604) Immunohistochemistry: BICC1 Antibody [NBP1-94171] - Staining of human kidney shows st...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BICC1 antibody (Bicaudal C Homolog 1 (Drosophila)) (ABIN4284604) Immunohistochemistry-Paraffin: BICC1 Antibody [NBP1-94171] - Immunohistochemical stai...
Western Blotting (WB) image for anti-BICC1 antibody (Bicaudal C Homolog 1 (Drosophila)) (ABIN4284604) Western Blot: BICC1 Antibody [NBP1-94171] - Lane 1: Marker [KDA] 250,130,95,72,55,36,...