Bicaudal D Homolog 1 (Drosophila) (BICD1) antibody

Details for Product No. ABIN4284608, Supplier: Log in to see
Antigen
  • BICD
  • B830009D06Rik
  • mKIAA4125
  • bicaudal D homolog 1
  • bicaudal D homolog 1 (Drosophila)
  • bicd1
  • BICD1
  • Bicd1
Alternatives
anti-Human Bicaudal D Homolog 1 (Drosophila) antibody for ELISA
Reactivity
Human
16
7
7
1
1
1
1
1
1
Host
Rabbit
15
1
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
8
4
4
3
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name BICD1 (BICD1 Antibody Abstract)
Background Gene Symbol: BICD1
Gene ID 636
Pathways Ribonucleoprotein Complex Subunit Organization, Regulation of G-Protein Coupled Receptor Protein Signaling, Maintenance of Protein Location
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bicaudal D Homolog 1 (Drosophila) (BICD1) antibody (ABIN4284608) Immunohistochemistry-Paraffin: BICD1 Antibody [NBP1-85843] - Staining of human rectum...
Western Blotting (WB) image for anti-Bicaudal D Homolog 1 (Drosophila) (BICD1) antibody (ABIN4284608) Western Blot: BICD1 Antibody [NBP1-85843] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Product cited in: Terenzio, Golding, Russell, Wicher, Rosewell, Spencer-Dene, Ish-Horowicz, Schiavo: "Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors." in: The EMBO journal, Vol. 33, Issue 14, pp. 1582-98, 2014 (PubMed).