Carboxylesterase 4A (CES4A) antibody

Details for Product No. ABIN4287851, Supplier: Log in to see
Antigen
  • Ces8
  • RGD1307418
  • CES8
  • 9130231C15Rik
  • AI266984
  • Ces6
  • CES6
  • carboxylesterase 4A
  • carboxylesterase 2A
  • Ces4a
  • CES4A
  • Ces2a
Reactivity
Human
22
5
5
2
2
2
1
Host
Rabbit
25
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
23
15
14
5
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Carboxylesterase 4A (CES4A Antibody Abstract)
Background Gene Symbol: CES4A
Gene ID 283848
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Carboxylesterase 4A (CES4A) antibody (ABIN4287851) Immunohistochemistry: carboxylesterase 4A Antibody [NBP1-90638] - Staining of human s...
Immunofluorescence (IF) image for anti-Carboxylesterase 4A (CES4A) antibody (ABIN4287851) Immunofluorescence: carboxylesterase 4A Antibody [NBP1-90638] - Analysis of human cel...
Did you look for something else?