Complement Factor B antibody (CFB)

Details for Product anti-CFB Antibody No. ABIN4299962, Supplier: Log in to see
Antigen
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • fc04c04
  • wu:fc04c04
  • bf/c2
  • CFB
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • zgc:158446
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
  • complement factor B-like
  • CFB
  • cfb
  • Bf
  • bfb-A
  • LOC397725
  • zgc:158446
  • bf/c2
  • Atp5s
  • Cfb
  • LOC100355944
Alternatives
anti-Human Complement Factor B antibody for Immunohistochemistry (Frozen Sections)
Reactivity
Human, Mouse (Murine), Rat (Rattus)
179
49
46
2
1
1
1
1
1
Host
Rabbit
130
57
16
7
Clonality
Polyclonal
Conjugate
This Complement Factor B antibody is un-conjugated
22
17
9
4
4
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
140
124
53
30
24
20
16
13
13
12
9
6
6
5
4
3
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Complement Factor B (CFB Antibody Abstract)
Background Gene Symbol: CFB
Gene ID 629
Pathways Complement System, Proton Transport, Ribonucleoside Biosynthetic Process
Application Notes Western Blot 1:100-1:500, Simple Western 1:20, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Simple Western (SimWes) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view ...
Western Blotting (WB) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: NIH-3T3 cell lysate...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining o...
Western Blotting (WB) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: Marker [kDa] 219, 1...
Simple Western (SimWes) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s)...
Product cited in: Yamanaka, Kakuta, Miyagawa, Nakazawa, Kato, Abe, Imamura, Okumi, Maeda, Okuyama, Mizuno, Nonomura: "Depression of Complement Regulatory Factors in Rat and Human Renal Grafts Is Associated with the Progress of Acute T-Cell Mediated Rejection." in: PLoS ONE, Vol. 11, Issue 2, pp. e0148881, 2016 (PubMed). (Sample species: Rat (Rattus)). Further details: Immunohistochemistry (Frozen Sections)

Cima, Schiess, Wild, Kaelin, Schüffler, Lange, Picotti, Ossola, Templeton, Schubert, Fuchs, Leippold, Wyler, Zehetner, Jochum, Buhmann, Cerny, Moch, Gillessen, Aebersold, Krek: "Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 108, Issue 8, pp. 3342-7, 2011 (PubMed).

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011 (PubMed).

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." in: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009 (PubMed).

Did you look for something else?