Deoxyhypusine Synthase (DHPS) antibody

Details for Product No. ABIN4305153, Supplier: Log in to see
Antigen
  • MGC76269
  • zgc:56018
  • zgc:77325
  • wu:fb52g04
  • wu:fj48f12
  • zgc:111900
  • MGC82178
  • DDBDRAFT_0186679
  • DDBDRAFT_0266388
  • DDB_0186679
  • DDB_0266388
  • DHS
  • DS
  • MIG13
  • Dhs
  • DYS
  • EDA22
  • K18J17.7
  • K18J17_7
  • deoxyhypusine synthase
  • embryo sac development arrest 22
  • deoxyhypusine synthase
  • Deoxyhypusine synthase
  • DHPS
  • dhps
  • Shell_1081
  • PF14_0125
  • CNJ02480
  • Tb10.70.4900
  • Tb927.1.870
  • Mmah_1888
  • Tagg_0666
  • Tagg_1037
  • Mesil_2448
  • Trad_0088
  • Igag_1842
  • Desac_0724
  • Mzhil_1083
  • Mzhil_1149
  • Mzhil_1233
  • Dhps
  • DHS
Reactivity
Human
69
24
20
5
2
2
2
2
1
1
Host
Rabbit
62
8
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
55
23
13
7
6
4
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKC
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name DHPS (DHPS Antibody Abstract)
Background Gene Symbol: DHPS
Gene ID 1725
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Deoxyhypusine Synthase (DHPS) antibody (ABIN4305153) Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human testis ...
Western Blotting (WB) image for anti-Deoxyhypusine Synthase (DHPS) antibody (ABIN4305153) Western Blot: DHPS Antibody [NBP1-82648] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-Deoxyhypusine Synthase (DHPS) antibody (ABIN4305153) Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of huma...
Product cited in: Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Did you look for something else?