DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) antibody

Details for Product No. ABIN4305178, Supplier: Log in to see
Antigen
  • fa91b12
  • zgc:55590
  • wu:fa91b12
  • dbp2
  • ddx16
  • pro2014
  • prp2
  • prp8
  • prpf2
  • DHX16
  • DKFZp459L1130
  • DBP2
  • DDX16
  • PRO2014
  • PRP8
  • PRPF2
  • Prp2
  • 2410006N22Rik
  • Ddx16
  • mKIAA0577
  • Dbp2
  • DEAH (Asp-Glu-Ala-His) box polypeptide 16
  • dhx16
  • DHX16
  • LOC100358431
  • Dhx16
Reactivity
Human
27
10
6
5
4
4
3
3
3
3
2
1
1
1
Host
Rabbit
17
11
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
25
7
6
5
4
3
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: HMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAAS QEPKYQLVLEEEETIEFVRATQLQGD
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name DHX16 (DHX16 Antibody Abstract)
Background Gene Symbol: DHX16
Gene ID 8449
Research Area DNA/RNA, Chromatin and Nuclear Signaling
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) antibody (ABIN4305178) Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining of human kidney...
Immunofluorescence (IF) image for anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) antibody (ABIN4305178) Immunocytochemistry/Immunofluorescence: DHX16 Antibody [NBP2-13920] Staining of human...
Did you look for something else?