Deoxyribonuclease II, Lysosomal (DNASE2) antibody

Details for Product No. ABIN4305664, Supplier: Log in to see
Antigen
  • CG7780
  • DNase
  • DNase 1
  • DNase-1
  • DNase1
  • Dmel\\CG7780
  • dDNase II
  • dnase2
  • MGC80103
  • DNASE2
  • LOC733868
  • fa92d01
  • wu:fa56d08
  • wu:fa92d01
  • DDBDRAFT_0188966
  • DDBDRAFT_0252883
  • DDB_0188966
  • DDB_0252883
  • Dnase2
  • DNASE2A
  • DNL
  • DNL2
  • Dnase2a
  • Deoxyribonuclease II
  • deoxyribonuclease II, lysosomal
  • deoxyribonuclease II
  • deoxyribonuclease II alpha
  • DNaseII
  • dnase2
  • DNASE2
  • LOC733868
  • Dnase2a
  • Dnase2
Reactivity
Human
50
21
19
Host
Rabbit
48
4
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
34
14
12
11
6
4
4
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR
Purification Immunogen affinity purified
Alternative Name DNase II (DNASE2 Antibody Abstract)
Background Gene Symbol: DNASE2
Gene ID 1777
UniProt O00115
Research Area Enzymes, Cell Cycle, Chromatin and Nuclear Signaling, Apoptosis/Necrosis
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Deoxyribonuclease II, Lysosomal (DNASE2) antibody (ABIN4305664) Immunohistochemistry: DNase II Antibody [NBP2-39068] - Staining of human liver shows ...