Glutaminase antibody (GLS)

Details for Product anti-GLS Antibody No. ABIN4314688, Supplier: Log in to see
Antigen
  • GA
  • PAG
  • AI314027
  • 6330442B14
  • B230365M23Rik
  • gls
  • si:dz87i4.2
  • wu:fa97e05
  • CG8772
  • CG8872
  • Dmel\\CG42708
  • Dmel_CG8772
  • BA3155
  • AAD20
  • GAC
  • GAM
  • GLS1
  • KGA
  • Glut
  • RATGLUT
  • A330074B06Rik
  • AI195532
  • GLS
  • Lga
  • glutaminase
  • glutaminase b
  • CG42708 gene product from transcript CG42708-RA
  • hypothetical protein
  • Glutaminase
  • glutaminase 2 (liver, mitochondrial)
  • GLS
  • Gls
  • gls
  • glsb
  • CG42708
  • glutaminase
  • glsA-2
  • Arnit_3113
  • Celal_2913
  • Odosp_0379
  • Odosp_1505
  • Celly_0289
  • Weevi_2101
  • Mesop_4683
  • Gls2
Alternatives
anti-Human Glutaminase antibody for Immunofluorescence
Reactivity
Human, Mouse (Murine)
90
60
32
4
2
2
2
2
1
1
Host
Rabbit
63
34
Clonality
Polyclonal
Conjugate
This Glutaminase antibody is un-conjugated
6
6
6
3
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
79
43
40
32
26
23
13
12
5
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Glutaminase (GLS Antibody Abstract)
Background Gene Symbol: GLS
Gene ID 2744
Research Area Signaling, Metabolism, Amino Acids
Pathways Feeding Behaviour, Dicarboxylic Acid Transport
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Glutaminase (GLS) antibody (ABIN4314688) Immunohistochemistry: Glutaminase Antibody [NBP1-89766] - Staining of human kidney sh...
Immunofluorescence (IF) image for anti-Glutaminase (GLS) antibody (ABIN4314688) Immunocytochemistry/Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining ...
Western Blotting (WB) image for anti-Glutaminase (GLS) antibody (ABIN4314688) Western Blot: Glutaminase Antibody [NBP1-89766] - Lane 1: Marker [kDa] 250, 130, 100,...
Immunofluorescence (IF) image for anti-Glutaminase (GLS) antibody (ABIN4314688) Immunocytochemistry/Immunofluorescence: Glutaminase Antibody - Immunofluorescent sta...
Product cited in: Tanaka, Sasayama, Irino, Takata, Nagashima, Satoh, Kyotani, Mizowaki, Imahori, Ejima, Masui, Gini, Yang, Hosoda, Sasaki, Mischel, Kohmura: "Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment." in: The Journal of clinical investigation, Vol. 125, Issue 4, pp. 1591-602, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Did you look for something else?