LEF1 antibody (Lymphoid Enhancer-Binding Factor 1)

Details for Product anti-LEF1 Antibody No. ABIN4330626, Supplier: Log in to see
Antigen
  • LEF1
  • 3000002B05
  • AI451430
  • Lef-1
  • LEF-1
  • TCF10
  • TCF1ALPHA
  • TCF7L3
  • lymphoid enhancer-binding factor 1
  • lymphocyte enhancer binding factor 1
  • lymphoid enhancer binding factor 1
  • lymphoid enhancer factor XLEF-1B
  • LEF1
  • LOC100352691
  • lef1
  • Lef1
Alternatives
anti-Human LEF1 antibody for Enzyme Immunoassay
Reactivity
Human
128
42
32
11
7
7
5
5
4
4
4
4
3
2
1
1
Host
Rabbit
56
52
16
5
Clonality
Polyclonal
Conjugate
This LEF1 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
115
67
21
16
9
6
5
3
2
2
2
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name LEF1 (LEF1 Antibody Abstract)
Background Gene Symbol: LEF1
Gene ID 51176
Research Area Lineage Markers, Transcription Factors, Wnt
Pathways WNT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Hormone Metabolic Process, Nuclear Hormone Receptor Binding, Chromatin Binding
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Western Blot: LEF1 Antibody [NBP1-86960] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunocytochemistry/Immunofluorescence: LEF1 Antibody [NBP1-86960] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph n...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody - Staining of human tonsil shows modera...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody - Staining of human lymph node shows mo...
Immunofluorescence (IF) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunocytochemistry/Immunofluorescence: LEF1 Antibody - Staining of human cell line ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody - Staining of human pancreas shows no n...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Lymphoid Enhancer-Binding Factor 1 (LEF1) antibody (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody - Staining of human oral mucosa shows m...
Product cited in: Asplund, Gry Björklund, Sundquist, Strömberg, Edlund, Ostman, Nilsson, Pontén, Lundeberg: "Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma." in: The British journal of dermatology, Vol. 158, Issue 3, pp. 527-38, 2008 (PubMed).

Did you look for something else?