MDH2 antibody (Malate Dehydrogenase 2, NAD (Mitochondrial))

Details for Product anti-MDH2 Antibody No. ABIN4333314, Supplier: Log in to see
Antigen
  • Mdh2b
  • m-mdh
  • mdh2
  • mor1
  • MDH-2
  • Mdh
  • wu:fj48c08
  • wu:fj55d06
  • zgc:64133
  • M-MDH
  • MDH
  • MGC:3559
  • MOR1
  • MMDH
  • Mdh-2
  • Mor-1
  • Mor1
  • malate dehydrogenase 2, NAD (mitochondrial)
  • Malate dehydrogenase 2
  • malate dehydrogenase
  • mdh2-b
  • MDH2
  • Mdh2
  • MDH4
  • mdh2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
62
22
13
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
47
14
2
Clonality
Polyclonal
Conjugate
This MDH2 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
53
33
16
14
5
5
3
3
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name MDH2 (MDH2 Antibody Abstract)
Background Gene Symbol: MDH2
Gene ID 4191
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2) antibody (ABIN4333314) Western Blot: MDH2 Antibody [NBP1-86036] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Western Blotting (WB) image for anti-Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2) antibody (ABIN4333314) Western Blot: MDH2 Antibody [NBP1-86036] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2) antibody (ABIN4333314) Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-86036] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2) antibody (ABIN4333314) Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human stomach...
Immunofluorescence (IF) image for anti-Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2) antibody (ABIN4333314) Immunocytochemistry/Immunofluorescence: MDH2 Antibody - Staining of human cell line ...
Product cited in: Rzem, Achouri, Marbaix, Schakman, Wiame, Marie, Gailly, Vincent, Veiga-da-Cunha, Van Schaftingen: "A mouse model of L-2-hydroxyglutaric aciduria, a disorder of metabolite repair." in: PLoS ONE, Vol. 10, Issue 3, pp. e0119540, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting

Shin, Krey, Hassan, Metlagel, Tauscher, Pagana, Sherman, Jeffery, Spinelli, Zhao, Wilmarth, Choi, David, Auer, Barr-Gillespie: "Molecular architecture of the chick vestibular hair bundle." in: Nature neuroscience, Vol. 16, Issue 3, pp. 365-74, 2013 (PubMed).

Did you look for something else?