MS4A3 antibody (Membrane-Spanning 4-Domains, Subfamily A, Member 3)

Details for Product anti-MS4A3 Antibody No. ABIN4335815, Supplier: Log in to see
Antigen
  • HTm4
  • mHTm4
  • CD20L
  • HTM4
  • membrane-spanning 4-domains, subfamily A, member 3
  • membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
  • LOC100351131
  • Ms4a3
  • MS4A3
Reactivity
Human
41
Host
Rabbit
21
20
Clonality
Polyclonal
Conjugate
This MS4A3 antibody is un-conjugated
3
2
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
22
17
14
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name MS4A3 (MS4A3 Antibody Abstract)
Background Gene Symbol: MS4A3
Gene ID 932
Research Area Kinases/Phosphatases
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Membrane-Spanning 4-Domains, Subfamily A, Member 3 (MS4A3) antibody (ABIN4335815) Immunohistochemistry-Paraffin: MS4A3 Antibody [NBP1-86543] - Staining of human bone m...
Immunofluorescence (IF) image for anti-Membrane-Spanning 4-Domains, Subfamily A, Member 3 (MS4A3) antibody (ABIN4335815) Immunocytochemistry/Immunofluorescence: MS4A3 Antibody [NBP1-86543] - Immunofluoresce...
Western Blotting (WB) image for anti-Membrane-Spanning 4-Domains, Subfamily A, Member 3 (MS4A3) antibody (ABIN4335815) Western Blot: MS4A3 Antibody [NBP1-86543] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Product cited in: Heller, Rommer, Steinleitner, Etzler, Hackl, Heffeter, Tomasich, Filipits, Steinmetz, Topakian, Klingenbrunner, Ziegler, Spittler, Zöchbauer-Müller, Berger, Wieser: "EVI1 promotes tumor growth via transcriptional repression of MS4A3." in: Journal of hematology & oncology, Vol. 8, pp. 28, 2015 (PubMed). Further details: Immunocytochemistry,Immunofluorescence

Did you look for something else?