NDRG Family Member 4 (NDRG4) antibody

Details for Product No. ABIN4338344, Supplier: Log in to see
  • ndrg3
  • ndrg4
  • smap-8
  • NDRG4
  • D8Bwg1337e
  • Ndr1-rs
  • Ndr4
  • R74996
  • SMAP-8
  • BDM1
  • SMAP8
  • Bdm1
  • smap8
  • NDRG family member 4
  • NDRG family member 4 S homeolog
  • NDRG family member 3
  • N-myc downstream regulated gene 4
  • NDRG4
  • ndrg4.S
  • ndrg3
  • Ndrg4
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name NDRG4 (NDRG4 Antibody Abstract)
Background Gene Symbol: NDRG4
Gene ID 65009
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NDRG Family Member 4 (NDRG4) antibody (ABIN4338344) Immunohistochemistry-Paraffin: NDRG4 Antibody [NBP1-81434] - Immunohistochemical stai...
Western Blotting (WB) image for anti-NDRG Family Member 4 (NDRG4) antibody (ABIN4338344) Western Blot: NDRG4 Antibody [NBP1-81434] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-NDRG Family Member 4 (NDRG4) antibody (ABIN4338344) Immunohistochemistry-Paraffin: NDRG4 Antibody - Staining of human cerebellum shows m...
Product cited in: Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Schilling, Hjelmeland, Radiloff, Liu, Wakeman, Fielhauer, Foster, Lathia, Rich, Wang, Datto: "NDRG4 is required for cell cycle progression and survival in glioblastoma cells." in: The Journal of biological chemistry, Vol. 284, Issue 37, pp. 25160-9, 2009 (PubMed).

Did you look for something else?