NDUFAF4 antibody (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, Assembly Factor 4)

Details for Product anti-NDUFAF4 Antibody No. ABIN4338380, Supplier: Log in to see
Antigen
  • C6orf66
  • 1110007M04Rik
  • 3000003G13Rik
  • AW214064
  • C9H6ORF66
  • HRPAP20
  • My013
  • bA22L21.1
  • Hrpap20
  • NADH:ubiquinone oxidoreductase complex assembly factor 4
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4
  • NDUFAF4
  • Ndufaf4
Reactivity
Human
27
3
3
Host
Rabbit
27
Clonality
Polyclonal
Conjugate
This NDUFAF4 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
26
16
16
5
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name NDUFAF4 (NDUFAF4 Antibody Abstract)
Background Gene Symbol: NDUFAF4
Gene ID 29078
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunofluorescence
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, Assembly Factor 4 (NDUFAF4) antibody (ABIN4338380) Immunohistochemistry-Paraffin: NDUFAF4 Antibody [NBP1-92171] - Staining of human brea...
Immunofluorescence (IF) image for anti-NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, Assembly Factor 4 (NDUFAF4) antibody (ABIN4338380) Immunofluorescence: NDUFAF4 Antibody [NBP1-92171] - Immunofluorescent staining of hum...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, Assembly Factor 4 (NDUFAF4) antibody (ABIN4338380) Immunohistochemistry-Paraffin: NDUFAF4 Antibody - Staining of human prostate shows m...
Did you look for something else?