LCP1 antibody (Lymphocyte Cytosolic Protein 1)

Details for Product anti-LCP1 Antibody No. ABIN4346103, Supplier: Log in to see
Antigen
  • cb245
  • fj24b12
  • wu:fj24b12
  • AW536232
  • D14Ertd310e
  • LCP-1
  • Pls2
  • pp65
  • CP64
  • L-PLASTIN
  • LC64P
  • LPL
  • PLS2
  • cp64
  • l-plastin
  • lc64p
  • lpl
  • pls2
  • plastin-2
  • 5730589K01Rik
  • A630040M18
  • AA410149
  • LCP1
  • lymphocyte cytosolic plastin 1
  • lymphocyte cytosolic protein 1
  • lymphocyte cytosolic protein 1 (L-plastin)
  • TOX high mobility group box family member 4
  • lcp1
  • Lcp1
  • LCP1
  • Tox4
Reactivity
Human, Mouse (Murine), Rat (Rattus)
76
31
29
8
5
4
4
4
4
3
3
3
2
1
1
Host
Rabbit
67
19
3
Clonality
Polyclonal
Conjugate
This LCP1 antibody is un-conjugated
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
68
36
21
13
12
11
11
7
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Plastin L (LCP1 Antibody Abstract)
Background Gene Symbol: LCP1
Gene ID 3936
Research Area Microfilaments, Cytoskeleton, Cancer
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Lymphocyte Cytosolic Protein 1 (LCP1) antibody (ABIN4346103) Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Immunofluorescence (IF) image for anti-Lymphocyte Cytosolic Protein 1 (LCP1) antibody (ABIN4346103) Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP1-88057] - Staining of...
Western Blotting (WB) image for anti-Lymphocyte Cytosolic Protein 1 (LCP1) antibody (ABIN4346103) Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lymphocyte Cytosolic Protein 1 (LCP1) antibody (ABIN4346103) Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - staining of human sp...
Product cited in: Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014 (PubMed).

Did you look for something else?