PPM1E antibody (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1E)

Details for Product anti-PPM1E Antibody No. ABIN4347051, Supplier: Log in to see
Antigen
  • AW049266
  • B930008A12Rik
  • POPX1
  • PP2CH
  • mKIAA1072
  • CaMKP-N
  • caMKN
  • protein phosphatase 1E (PP2C domain containing)
  • protein phosphatase, Mg2+/Mn2+ dependent, 1E
  • Ppm1e
  • PPM1E
Reactivity
Human
17
Host
Rabbit
17
Clonality
Polyclonal
Conjugate
This PPM1E antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
15
14
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name PPM1E (PPM1E Antibody Abstract)
Background Gene Symbol: PPM1E
Gene ID 22843
Research Area Signaling
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-PPM1E antibody (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1E) (ABIN4347051) Immunohistochemistry: PPM1E Antibody [NBP1-86650] - Staining of human rectum shows st...