SERPINB2 antibody (Plasminogen Activator Inhibitor 2)

Details for Product anti-SERPINB2 Antibody No. ABIN4352989, Supplier: Log in to see
Antigen
  • HsT1201
  • PAI
  • PAI-2
  • PAI2
  • PLANH2
  • LOC100101625
  • SERPINB2
  • Planh2
  • ovalbumin
  • Pai2a
  • serpin peptidase inhibitor, clade B (ovalbumin), member 2
  • plasminogen activator inhibitor 2
  • serine (or cysteine) peptidase inhibitor, clade B, member 2
  • SERPINB2
  • LOC100101625
  • Serpinb2
Alternatives
anti-Human SERPINB2 antibody for ELISA
Reactivity
Human
112
34
29
4
4
4
3
3
3
2
2
Host
Rabbit
91
35
4
1
Clonality
Polyclonal
Conjugate
This SERPINB2 antibody is un-conjugated
6
6
3
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
103
46
34
27
26
13
9
8
4
3
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKD
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name SerpinB2 (SERPINB2 Antibody Abstract)
Background Gene Symbol: SERPINB2
Molecular Weight Theoretical MW: 47 kDa
Gene ID 5055
UniProt P05120
Research Area Proteolysis / Ubiquitin, Innate Immunity
Pathways Autophagy
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF Fixation/Permeabilization: PFA/Triton X-100 is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SERPINB2 antibody (Plasminogen Activator Inhibitor 2) (ABIN4352989) Immunohistochemistry-Paraffin: SerpinB2 Antibody [NBP1-83163] - Immunohistochemical s...
Immunofluorescence (IF) image for anti-SERPINB2 antibody (Plasminogen Activator Inhibitor 2) (ABIN4352989) Immunocytochemistry/Immunofluorescence: SerpinB2 Antibody [NBP1-83163] - Staining of ...
Product cited in: Bruin, Asadi, Fox, Erener, Rezania, Kieffer: "Accelerated Maturation of Human Stem Cell-Derived Pancreatic Progenitor Cells into Insulin-Secreting Cells in Immunodeficient Rats Relative to Mice." in: Stem cell reports, Vol. 5, Issue 6, pp. 1081-96, 2015 (PubMed). (Sample species: Human). Further details: Immunohistochemistry (Paraffin-embedded Sections)

Poaty, Coullin, Peko, Dessen, Diatta, Valent, Leguern, Prévot, Gombé-Mbalawa, Candelier, Picard, Bernheim: "Genome-wide high-resolution aCGH analysis of gestational choriocarcinomas." in: PLoS ONE, Vol. 7, Issue 1, pp. e29426, 2012 (PubMed).

Lindskog, Korsgren, Pontén, Eriksson, Johansson, Danielsson: "Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates." in: Journal of proteomics, Vol. 75, Issue 9, pp. 2611-20, 2012 (PubMed).

Castello-Cros, Bonuccelli, Molchansky, Capozza, Witkiewicz, Birbe, Howell, Pestell, Whitaker-Menezes, Sotgia, Lisanti: "Matrix remodeling stimulates stromal autophagy, "fueling" cancer cell mitochondrial metabolism and metastasis." in: Cell cycle (Georgetown, Tex.), Vol. 10, Issue 12, pp. 2021-34, 2011 (PubMed).