TBX2 antibody (T-Box 2)

Details for Product anti-TBX2 Antibody No. ABIN4358058, Supplier: Log in to see
Antigen
  • Xltbx2
  • tbx2
  • xtbx2
  • hm:zeh1581
  • tbx-c
  • tbxc
  • zeh1581
  • TBX2
  • T-box 2
  • T-box 2 L homeolog
  • T-box 2b
  • T-box protein 2
  • TBX2
  • tbx2.L
  • tbx2b
  • tbx2
  • tbx-2
  • Tbx2
Alternatives
anti-Human TBX2 antibody for ELISA
Reactivity
Human
72
18
10
4
4
3
2
2
2
2
2
1
Host
Rabbit
50
23
1
Clonality
Polyclonal
Conjugate
This TBX2 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
61
45
14
9
8
6
5
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name TBX2 (TBX2 Antibody Abstract)
Background Gene Symbol: TBX2
Gene ID 6909
Pathways p53 Signaling
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. For IF Fixation/Permeabilization: PFA/Triton X-100 is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-T-Box 2 (TBX2) antibody (ABIN4358058) Immunocytochemistry/Immunofluorescence: TBX2 Antibody - Staining of human cell line ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-T-Box 2 (TBX2) antibody (ABIN4358058) Immunohistochemistry-Paraffin: TBX2 Antibody - Staining of human stomach shows stron...
Product cited in: Schneider, Scheffer, Bund, Boukhallouk, Lambert, Cotarelo, Pflugfelder, Florin, Spoden: "The transcription factors TBX2 and TBX3 interact with human papillomavirus 16 (HPV16) L2 and repress the long control region of HPVs." in: Journal of virology, Vol. 87, Issue 8, pp. 4461-74, 2013 (PubMed).

Saadi, Das, Zhao, Raj, Ruspita, Xia, Papaioannou, Bei: "Msx1 and Tbx2 antagonistically regulate Bmp4 expression during the bud-to-cap stage transition in tooth development." in: Development (Cambridge, England), Vol. 140, Issue 13, pp. 2697-702, 2013 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Did you look for something else?