Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486808

Lipase, Endothelial (LIPG) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EL, EDL, PRO719, LIPG, mEDL, lipase, 3110013K01Rik, zgc:55345, MGC69106, lipe
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN486808
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
Sequence VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMK NETSPTVELP
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 76%
Characteristics This is a rabbit polyclonal antibody against LIPG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LIPG
Background LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.
Molecular Weight 55kDa
Gene ID 9388
NCBI Accession NP_006024, NM_006033
UniProt Q9Y5X9
Research Area Cardiovascular, Atherosclerosis, Metabolism, Enzymes
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LIPG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Willer, Sanna, Jackson et al.: "Newly identified loci that influence lipid concentrations and risk of coronary artery disease." in: Nature genetics, Vol. 40, Issue 2, pp. 161-9, 2008 (PubMed).

Alternatives for antigen "Lipase, Endothelial (LIPG)", type "Antibodies"
Hosts (77), (56), (6)
Reactivities (130), (28), (26), (14), (13), (12), (12), (3), (2)
Applications (111), (37), (30), (29), (28), (19), (19), (16), (6), (4), (3), (2), (1)
Conjugates (7), (7), (5), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (9), (9), (4), (3), (2), (2), (2), (1)
Beacon