Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486825

Claudin 7 (CLDN7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1, cb388, claudin7, cldn7, wu:fd19f08, MGC53400, MGC75689, CLDN7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486825
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7
Sequence GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSY PKSNSSKEYV
Predicted Reactivity Dog : 93%, Horse : 93%, Mouse : 93%, Rat : 93%, Sheep : 93%
Characteristics This is a rabbit polyclonal antibody against CLDN7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CLDN7
Background Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).
Molecular Weight 22kDa
Gene ID 1366
NCBI Accession NP_001298, NM_001307
UniProt O95471
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLDN7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kleinberg, Holth, Trope et al.: "Claudin upregulation in ovarian carcinoma effusions is associated with poor survival." in: Human pathology, Vol. 39, Issue 5, pp. 747-57, 2008 (PubMed).

Alternatives for antigen "Claudin 7 (CLDN7)", type "Antibodies"
Hosts (72), (2)
Reactivities (68), (50), (48), (18), (18), (1), (1), (1), (1), (1)
Applications (44), (29), (29), (20), (19), (10), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (18), (5), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon