Did you know that you can buy products from over 140 different suppliers from us?

Claudin 7 (CLDN7) (C-Term) antibody

Details for Product No. ABIN486825
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1, cb388, claudin7, cldn7, wu:fd19f08, MGC53400, MGC75689, CLDN7
Epitope
C-Term
(29), (7), (7), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(80), (55), (52), (18), (18), (1)
Host
Rabbit
(85), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(57), (38), (31), (28), (14), (11), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN486825
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CLDN7
Sequence GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSY PKSNSSKEYV
Predicted Reactivity Dog : 93 %, Horse : 93 %, Mouse : 93 %, Rat : 93 %, Sheep : 93 %
Characteristics This is a rabbit polyclonal antibody against CLDN7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CLDN7
Background Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).
Molecular Weight 22 kDa
Gene ID 1366
NCBI Accession NM_001307, NP_001298
UniProt O95471
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 211 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Claudin 7 (CLDN7) (C-Term) antibody WB Suggested Anti-CLDN7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Kleinberg, Holth, Trope et al.: "Claudin upregulation in ovarian carcinoma effusions is associated with poor survival." in: Human pathology, Vol. 39, Issue 5, pp. 747-57, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN486825
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top