Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486835

Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486835
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7
Sequence MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDG NGQESLSMSS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCF7
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 30kDa
Gene ID 6932
NCBI Accession NP_963964, NM_201633
UniProt P36402-2
Research Area Stem Cells, Transcription Factors, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCF7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Willinger, Freeman, Herbert et al.: "Human naive CD8 T cells down-regulate expression of the WNT pathway transcription factors lymphoid enhancer binding factor 1 and transcription factor 7 (T cell factor-1) following antigen encounter in vitro and in vivo." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 176, Issue 3, pp. 1439-46, 2006 (PubMed).

Alternatives for antigen "Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)", type "Antibodies"
Hosts (24), (8), (2)
Reactivities (34), (11), (3), (2), (2)
Applications (32), (16), (5), (4), (3), (2), (2), (1), (1), (1)
Epitopes (7), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon