Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody

Details for Product No. ABIN486835
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Epitope
Middle Region
(7), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(39), (12), (3), (3), (2)
Host
Rabbit
(29), (8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(37), (15), (5), (4), (3), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN486835
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TCF7
Sequence MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDG NGQESLSMSS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCF7
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 30 kDa
Gene ID 6932
NCBI Accession NM_201633, NP_963964
UniProt P36402-2
Research Area Stem Cells, Wnt, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 269 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
Background publications Willinger, Freeman, Herbert et al.: "Human naive CD8 T cells down-regulate expression of the WNT pathway transcription factors lymphoid enhancer binding factor 1 and transcription factor 7 (T cell factor-1) following antigen encounter in vitro and in vivo." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 176, Issue 3, pp. 1439-46, 2006 (PubMed).

Hosts (29), (8), (2)
Reactivities (39), (12), (3), (3), (2)
Applications (37), (15), (5), (4), (3), (3), (2), (1), (1), (1)
Epitopes (7), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top