Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486932

Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A, 3110032K11Rik, MEB1, Nil2, TCF-8, Tcf18, Tcf8, Tw, ZEB, Zfhep, Zfhx1a, Zfx1a, Zfx1ha, [delta]EF1, deltaEF1, areb6, bzp, deltaef1, fecd6, ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunofluorescence (IF)
Pubmed 2 references available
Catalog no. ABIN486932
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZEB1 antibody: synthetic peptide directed towards the N terminal of human ZEB1
Sequence KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ RQGTPEASGH
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against ZEB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZEB1
Background ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).
Molecular Weight 124kDa
Gene ID 6935
NCBI Accession NP_110378, NM_030751
UniProt P37275
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZEB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lobert, Graichen, Morris: "Coordinated Regulation of β-Tubulin Isotypes and Epithelial-to-Mesenchymal Transition Protein ZEB1 in Breast Cancer Cells." in: Biochemistry, Vol. 52, Issue 32, pp. 5482-90, 2013 (PubMed).

Background publications Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).

Alternatives for antigen "Zinc Finger E-Box Binding Homeobox 1 (ZEB1)", type "Antibodies"
Hosts (37), (11), (6)
Reactivities (53), (19), (17), (12), (12), (12), (12)
Applications (42), (25), (11), (10), (5), (3), (3), (2), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (6), (5), (2), (2), (1), (1), (1)
Beacon