Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody

Details for Product No. ABIN486932
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A, 3110032K11Rik, MEB1, Nil2, TCF-8, Tcf18, Tcf8, Tw, ZEB, Zfhep, Zfhx1a, Zfx1a, Zfx1ha, [delta]EF1, deltaEF1, areb6, bzp, deltaef1, fecd6, ... show more
AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A, 3110032K11Rik, MEB1, Nil2, TCF-8, Tcf18, Tcf8, Tw, ZEB, Zfhep, Zfhx1a, Zfx1a, Zfx1ha, [delta]EF1, deltaEF1, areb6, bzp, deltaef1, fecd6, nil-2a, nil2a, tcf8, zeb, zfhep, zfhx1, ZFH/[d]EF1, kheper, zeb1, zfhx1a, nil-2-a, MGC97552 show less
Epitope
N-Term
(7), (5), (5), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(56), (19), (18), (12), (12), (12), (12)
Host
Rabbit
(39), (13), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunofluorescence (IF), Western Blotting (WB)
(43), (26), (13), (10), (8), (5), (5), (3), (2), (2), (2)
Pubmed 2 references available
Catalog no. ABIN486932
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZEB1
Sequence KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQ RQGTPEASGH
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against ZEB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZEB1
Background ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).
Molecular Weight 124 kDa
Gene ID 6935
NCBI Accession NM_030751, NP_110378
UniProt P37275
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1124 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody (2) anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody (Image 2)
anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody (3) anti-Zinc Finger E-Box Binding Homeobox 1 (ZEB1) (N-Term) antibody (Image 3)
Product cited in: Lobert, Graichen, Morris: "Coordinated Regulation of β-Tubulin Isotypes and Epithelial-to-Mesenchymal Transition Protein ZEB1 in Breast Cancer Cells." in: Biochemistry, Vol. 52, Issue 32, pp. 5482-90, 2013 (PubMed).

Background publications Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).

Hosts (39), (13), (5)
Reactivities (56), (19), (18), (12), (12), (12), (12)
Applications (43), (26), (13), (10), (8), (5), (5), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (5), (5), (2), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top