Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486996

Potassium Channel Modulatory Factor 1 (KCMF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DEBT91, FIGC, PCMF, ZZZ1, Pmcf, Debt91, 1700094M07Rik, zgc:64160, figc, pcmf, zzz1, debt91, Kcmf1, ACYPI010132
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486996
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCMF1 antibody: synthetic peptide directed towards the N terminal of human KCMF1
Sequence SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVIC PICAALPGGD
Predicted Reactivity African clawed frog : 92%, Bovine : 92%, Chicken : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Human : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against KCMF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCMF1
Background KCMF1 belongs to the KCMF1 family. It contains 1 C2H2-type zinc finger and 1 ZZ-type zinc finger. It has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.
Molecular Weight 42kDa
Gene ID 56888
NCBI Accession NP_064507, NM_020122
UniProt Q9P0J7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCMF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kreppel, Aryee, Schaefer et al.: "Suppression of KCMF1 by constitutive high CD99 expression is involved in the migratory ability of Ewing's sarcoma cells." in: Oncogene, Vol. 25, Issue 19, pp. 2795-800, 2006 (PubMed).

Alternatives for antigen "Potassium Channel Modulatory Factor 1 (KCMF1)", type "Antibodies"
Hosts (7), (2)
Reactivities (9), (5), (1), (1), (1), (1)
Applications (7), (3), (2), (2)
Epitopes (6), (2), (2), (1)
Beacon