Suppressor of Fused Homolog (Drosophila) (SUFUH) (Middle Region) antibody

Details for Product No. ABIN487003
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2810026F04Rik, Su(fu), b2b273Clo, CG6054, Dmel\\CG6054, SU(FU), SUFU, Su(Fu), SuFu, Sufu, su(fu), sufu, dre, fi39e05, wu:fi39e05, Xsufu, sufuh, sufuxl, SUFUH, SUFUXL, PRO1280
Epitope
Middle Region
(7), (4), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(37), (20), (19), (15), (14), (13), (6), (3), (2), (2), (1)
Host
Rabbit
(39), (3), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (10), (8), (7), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN487003
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SUFU
Sequence NGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQER VDKGIETDGS
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Bovine : 90 %, Rat : 90 %, Zebrafish : 90 %, African clawed frog : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against SUFU. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SUFU
Background SUFU is a component of the Sonic hedgehog (SHH, MIM 600725)/Patched (PTCH, MIM 601309) signaling pathway. Mutations in genes encoding components of this pathway are deleterious for normal development and are associated with cancer-predisposing syndromes. SUFU encodes a component of the sonic hedgehog (SHH, MIM 600725)/patched (PTCH, MIM 601309) signaling pathway. Mutations in genes encoding components of this pathway are deleterious for normal development and are associated with cancer-predisposing syndromes (e.g., HPE3, MIM 142945, BCNS, MIM 109400, and GCPS, MIM 175700).
Molecular Weight 54 kDa
Gene ID 51684
NCBI Accession NM_016169, NP_057253
UniProt Q9UMX1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 484 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Suppressor of Fused Homolog (Drosophila) (SUFUH) (Middle Region) antibody WB Suggested Anti-SUFU Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate
Background publications Lee, Deng, Wang et al.: "MicroRNA-378 promotes cell survival, tumor growth, and angiogenesis by targeting SuFu and Fus-1 expression." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 51, pp. 20350-5, 2007 (PubMed).

Hosts (39), (3), (2)
Reactivities (37), (20), (19), (15), (14), (13), (6), (3), (2), (2), (1)
Applications (23), (10), (10), (8), (7), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (3), (2), (2), (1), (1), (1), (1)
back to top