Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 64 (Middle Region) antibody

Details for Product No. ABIN487024
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms znf64, znf338, ZNF338
Epitope
Middle Region
(10), (7), (5), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human
(24), (5), (5), (4), (4), (4), (3)
Host
Rabbit
(24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (8), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487024
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZFP64
Sequence AKKSFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTV LQFQIDPSKQ
Predicted Reactivity Dog : 92 %, Guinea pig : 92 %, Human : 92 %, Mouse : 82 %, Rat : 82 %, Pig : 72 %
Characteristics This is a rabbit polyclonal antibody against ZFP64. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZFP64
Background ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZFP64 may be involved in transcriptional regulation.
Molecular Weight 75 kDa
Gene ID 55734
NCBI Accession NM_018197, NP_060667
UniProt Q9NPA5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 681 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Validation Images
back to top