Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487042

Toll-Like Receptor 9 (TLR9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CD289
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487042
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TLR9 antibody: synthetic peptide directed towards the N terminal of human TLR9
Sequence VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLV LKDSSLSWLN
Predicted Reactivity Bovine : 100%, Goat : 100%, Horse : 100%, Human : 100%, Pig : 100%, Sheep : 100%, Mouse : 85%, Rabbit : 85%, Rat : 85%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against TLR9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TLR9
Background TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response.
Molecular Weight 113kDa
Gene ID 54106
NCBI Accession NP_059138, NM_017442
UniProt Q9NR96
Research Area Immunology, Innate Immunity, Signaling, Inflammation
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TLR9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ramirez-Ortiz, Specht, Wang et al.: "Toll-like receptor 9-dependent immune activation by unmethylated CpG motifs in Aspergillus fumigatus DNA." in: Infection and immunity, Vol. 76, Issue 5, pp. 2123-9, 2008 (PubMed).

Alternatives for antigen "Toll-Like Receptor 9 (TLR9)", type "Antibodies"
Hosts (95), (64), (16), (8), (5), (1)
Reactivities (154), (94), (40), (21), (14), (12), (9), (4), (2), (1), (1), (1), (1), (1)
Applications (157), (72), (66), (52), (25), (23), (23), (20), (14), (10), (3), (3), (2), (1), (1), (1), (1)
Conjugates (18), (12), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (20), (15), (13), (12), (6), (6), (5), (5), (4), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon