Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487104

Zinc Finger Protein 703 (ZNF703) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZEPPO1, ZNF503L, ZPO1, 1110032O19Rik, AI430822, AL022941, Csmn1, End2, Zeppo1, Znf703, Zpo1, NH11, cb514, fc45d06, fk28e09, nlz, nlz1, noz1, wu:fc45d06, wu:fk28e09, zgc:111927
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487104
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF703 antibody: synthetic peptide directed towards the C terminal of human ZNF703
Sequence LSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRL ASASALGYQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF703. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF703
Background ZNF703 belongs to the Elbow/Noc family. It contains 1 C2H2-type zinc finger.ZNF703 may function as a transcriptional repressor.
Molecular Weight 58kDa
Gene ID 80139
NCBI Accession NP_079345, NM_025069
UniProt Q9H7S9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF703 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Garcia, Pole, Chin et al.: "A 1 Mb minimal amplicon at 8p11-12 in breast cancer identifies new candidate oncogenes." in: Oncogene, Vol. 24, Issue 33, pp. 5235-45, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 703 (ZNF703)", type "Antibodies"
Hosts (11), (6)
Reactivities (14), (3), (3), (1), (1), (1)
Applications (13), (9), (1)
Epitopes (4), (3), (2), (2), (1), (1)
Beacon