Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487148

JAZF Zinc Finger 1 (JAZF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TIP27, ZNF802, AI591476, C820002C15, Jaz1, Tip27, JAZF1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487148
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-JAZF1 antibody: synthetic peptide directed towards the N terminal of human JAZF1
Sequence IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLK KKIQPKLSLT
Predicted Reactivity Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against JAZF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name JAZF1
Background JAZF1 is a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
Molecular Weight 27kDa
Gene ID 221895
NCBI Accession NP_778231, NM_175061
UniProt Q86VZ6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-JAZF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Thomas, Jacobs, Yeager et al.: "Multiple loci identified in a genome-wide association study of prostate cancer." in: Nature genetics, Vol. 40, Issue 3, pp. 310-5, 2008 (PubMed).

Alternatives for antigen "JAZF Zinc Finger 1 (JAZF1)", type "Antibodies"
Hosts (10), (2)
Reactivities (12), (5), (1), (1), (1)
Applications (12), (4), (4), (2), (1), (1)
Epitopes (5), (2), (2), (2), (2), (1)
Beacon