Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487163

2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OIAS, IFI-4, OIASI, OAS1, Oas1, Oas1g, Flv, L1, Mmu-L1, Oias-2, Oias2, Wnv
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN487163
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the N terminal of human OAS1
Sequence MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGF LKERCFRGSS
Predicted Reactivity Human : 100%, Bovine : 85%, Horse : 85%, Mouse : 85%, Dog : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against OAS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OAS1
Background This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactio
Molecular Weight 42kDa
Gene ID 4938
NCBI Accession NP_002525, NM_024833
UniProt P00973-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OAS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1)", type "Antibodies"
Hosts (42), (6), (1)
Reactivities (46), (19), (14), (3), (2), (1), (1), (1)
Applications (31), (21), (19), (10), (8), (4), (2), (1), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon