2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1) (N-Term) antibody

Details for Product No. ABIN487163
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OIAS, IFI-4, OIASI, OAS1, Oas1, Oas1g, Flv, L1, Mmu-L1, Oias-2, Oias2, Wnv
Epitope
N-Term
(18), (6), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(54), (19), (14), (4), (2), (1), (1), (1)
Host
Rabbit
(51), (4), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(40), (24), (18), (18), (10), (3), (2), (2), (1), (1), (1)
Pubmed 2 references available
Catalog no. ABIN487163
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human OAS1
Sequence MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGF LKERCFRGSS
Predicted Reactivity Human : 100 %, Bovine : 80 %, Horse : 80 %, Mouse : 80 %, Dog : 70 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against OAS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name OAS1
Background This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactio
Molecular Weight 42 kDa
Gene ID 4938
NCBI Accession NM_024833, NP_002525
UniProt P00973-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 364 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1) (N-Term) antibody Immunohistochemistry with Small intestine tissue at an antibody concentration of 5µg/ml using anti-OAS1 antibody (ARP40401_P050)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (51), (4), (2)
Reactivities (54), (19), (14), (4), (2), (1), (1), (1)
Applications (40), (24), (18), (18), (10), (3), (2), (2), (1), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (18), (6), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top