Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487193

ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI326318, AU016058, BB119416, EST201864, ABCF3, DKFZp459M1517
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487193
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABCF3 antibody: synthetic peptide directed towards the N terminal of human ABCF3
Sequence DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEP QSQGNSQVLL
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ABCF3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABCF3
Background ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
Molecular Weight 78kDa
Gene ID 55324
NCBI Accession NP_060828, NM_018358
UniProt Q9NUQ8
Research Area Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABCF3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dean, Rzhetsky, Allikmets: "The human ATP-binding cassette (ABC) transporter superfamily." in: Genome research, Vol. 11, Issue 7, pp. 1156-66, 2001 (PubMed).

Alternatives for antigen "ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3)", type "Antibodies"
Hosts (19), (5), (1)
Reactivities (21), (14), (14), (13), (12), (11)
Applications (14), (11), (9), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon