Did you know that you can buy products from over 140 different suppliers from us?

ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3) (N-Term) antibody

Details for Product No. ABIN487193
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI326318, AU016058, BB119416, EST201864, ABCF3, DKFZp459M1517
Epitope
N-Term
(2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(25), (14), (14), (12), (12), (11)
Host
Rabbit
(23), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (10), (9), (6), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487193
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ABCF3
Sequence DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEP QSQGNSQVLL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against ABCF3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ABCF3
Background ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
Molecular Weight 78 kDa
Gene ID 55324
NCBI Accession NM_018358, NP_060828
UniProt Q9NUQ8
Research Area Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 709 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3) (N-Term) antibody WB Suggested Anti-ABCF3 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Dean, Rzhetsky, Allikmets: "The human ATP-binding cassette (ABC) transporter superfamily." in: Genome research, Vol. 11, Issue 7, pp. 1156-66, 2001 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487193
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top