Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487202

Flavin Containing Monooxygenase 5 (FMO5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI195026, 5033418D19Rik, MGC68633, MGC108355, sb:cb1007, wu:fc05b01, wu:fk47g04
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487202
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FMO5 antibody: synthetic peptide directed towards the middle region of human FMO5
Sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRI ISGLVKVKGN
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, African clawed frog : 92%, Guinea pig : 92%, Rat : 85%, Pig : 82%
Characteristics This is a rabbit polyclonal antibody against FMO5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FMO5
Background Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting
Molecular Weight 59kDa
Gene ID 2330
NCBI Accession NP_001452, NM_001461
UniProt P49326
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FMO5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Flavin Containing Monooxygenase 5 (FMO5)", type "Antibodies"
Hosts (22), (2)
Reactivities (23), (15), (15), (12), (12), (12)
Applications (15), (10), (7), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon