Nucleolar Complex Associated 3 Homolog (S. Cerevisiae) (NOC3L) (N-Term) antibody

Details for Product No. ABIN487205
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Fad24, AF233884, RGD1560656, AD24, C10orf117, FAD24
Epitope
N-Term
(3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
(13), (7)
Host
Rabbit
(12), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (8)
Pubmed 1 reference available
Catalog no. ABIN487205
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NOC3L
Sequence TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIE REEEEEEEAL
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against NOC3L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NOC3L
Background NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.
Molecular Weight 92 kDa
Gene ID 64318
NCBI Accession NM_022451, NP_071896
UniProt Q8WTT2
Research Area Stem Cells, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 800 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (12), (2)
Reactivities (13), (7)
Applications (14), (8)
Epitopes (3), (2), (2), (2), (1)
back to top