Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487205

Nucleolar Complex Associated 3 Homolog (S. Cerevisiae) (NOC3L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Fad24, AF233884, RGD1560656, AD24, C10orf117, FAD24
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487205
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOC3L antibody: synthetic peptide directed towards the N terminal of human NOC3L
Sequence TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIE REEEEEEEAL
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against NOC3L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NOC3L
Background NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.
Molecular Weight 92kDa
Gene ID 64318
NCBI Accession NP_071896, NM_022451
UniProt Q8WTT2
Research Area Stem Cells, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOC3L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Alternatives for antigen "Nucleolar Complex Associated 3 Homolog (S. Cerevisiae) (NOC3L)", type "Antibodies"
Hosts (13), (2)
Reactivities (14), (5)
Applications (15), (8), (2), (1)
Epitopes (4), (2), (2), (1), (1)
Beacon