Did you know that you can buy products from over 140 different suppliers from us?

PAP Associated Domain Containing 4 (PAPD4) (N-Term) antibody

Details for Product No. ABIN487221
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GLD2, 8030446C20Rik, AI649009, GLD-2, Gld2
Epitope
N-Term
(9), (7), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(13), (2), (2), (2)
Host
Rabbit
(15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (8), (7), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487221
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PAPD4
Sequence GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGER RYSMPPLFHT
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against PAPD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PAPD4
Background PAPD4 is a cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. PAPD4 belongs to the DNA polymerase type-B-like family, GLD2 subfamily.
Molecular Weight 56 kDa
Gene ID 167153
NCBI Accession NM_173797, NP_776158
UniProt Q6PIY7
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 484 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PAP Associated Domain Containing 4 (PAPD4) (N-Term) antibody WB Suggested Anti-PAPD4 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (15)
Reactivities (13), (2), (2), (2)
Applications (15), (8), (7), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487221
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top