RHBG (C-Term) antibody

Details for Product No. ABIN487231
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SLC42A2
Epitope
C-Term
(12), (8), (2), (2), (2)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
(15), (4), (1), (1), (1), (1)
Host
Rabbit
(15), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(18), (12), (10), (8), (5)
Pubmed 1 reference available
Catalog no. ABIN487231
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RHBG
Sequence LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTL MFASVGGGLG
Predicted Reactivity Bovine : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against RHBG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.
Molecular Weight 47 kDa
Gene ID 57127
NCBI Accession NM_020407, NP_065140
UniProt Q9H310
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 441 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RHBG (C-Term) antibody WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-RHBG (C-Term) antibody (2) anti-RHBG (C-Term) antibody (Image 2)
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (15), (6)
Reactivities (15), (4), (1), (1), (1), (1)
Applications (18), (12), (10), (8), (5)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (12), (8), (2), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top