Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487239

Zinc Finger Protein 385B (ZNF385B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B830010L13Rik, C130013B13Rik, Zfp533, Znf385b, si:busm1-42h5.1, si:by51i9.1, si:dz145b16.1, si:dz42h5.1, si:xx-51i9.1, wu:fj47d04, zgc:73248, znf533, ZNF533, ZFN533, ZNF358
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN487239
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF385B antibody: synthetic peptide directed towards the C terminal of human ZNF385B
Sequence HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSP SILAAKLAFQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Chicken : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF385B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF385B
Background The exact function of ZNF385B remains unknown.
Molecular Weight 41kDa
Gene ID 151126
NCBI Accession NP_001106869, NM_001113398
UniProt Q569K4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF385B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 385B (ZNF385B)", type "Antibodies"
Hosts (3), (1)
Reactivities (4), (1)
Applications (4), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Beacon