Zinc Finger Protein 385B (ZNF385B) (C-Term) antibody

Details for Product No. ABIN487239
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms B830010L13Rik, C130013B13Rik, Zfp533, Znf385b, si:busm1-42h5.1, si:by51i9.1, si:dz145b16.1, si:dz42h5.1, si:xx-51i9.1, wu:fj47d04, zgc:73248, znf533, ZNF533, ZFN533, ZNF358
Epitope
C-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(4)
Host
Rabbit
(3), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (1), (1)
Pubmed 2 references available
Catalog no. ABIN487239
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF385B
Sequence HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSP SILAAKLAFQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Chicken : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF385B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF385B
Background The exact function of ZNF385B remains unknown.
Molecular Weight 41 kDa
Gene ID 151126
NCBI Accession NM_001113398, NP_001106869
UniProt Q569K4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 369 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 385B (ZNF385B) (C-Term) antibody WB Suggested Anti-ZNF385B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (3), (1)
Reactivities (4)
Applications (4), (1), (1)
Epitopes (1), (1), (1)
back to top