Chromosome 2 Open Reading Frame 42 (C2orf42) (N-Term) antibody

Details for Product No. ABIN487254
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C2orf42
Epitope
N-Term
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(4), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1)
Pubmed 1 reference available
Catalog no. ABIN487254
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C2orf42
Sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLS CKNKTCGTIF
Predicted Reactivity Chicken : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against C2orf42. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C2orf42
Background The exact function of C2orf42 remains unknown.
Molecular Weight 63 kDa
Gene ID 54980
NCBI Accession NM_017880, NP_060350
UniProt Q9NWW7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 574 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 2 Open Reading Frame 42 (C2orf42) (N-Term) antibody WB Suggested Anti-C2orf42 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (5), (1)
Reactivities (4), (1), (1), (1), (1), (1), (1)
Applications (6), (1)
Epitopes (2), (1)
back to top