Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487254

Chromosome 2 Open Reading Frame 42 (C2orf42) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2orf42
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487254
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C2orf42 antibody: synthetic peptide directed towards the N terminal of human C2orf42
Sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLS CKNKTCGTIF
Predicted Reactivity Chicken : 100%, Horse : 100%, Human : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against C2orf42. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C2orf42
Background The exact function of C2orf42 remains unknown.
Molecular Weight 63kDa
Gene ID 54980
NCBI Accession NP_060350, NM_017880
UniProt Q9NWW7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C2orf42 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Chromosome 2 Open Reading Frame 42 (C2orf42)", type "Antibodies"
Hosts (5)
Reactivities (3), (1), (1), (1), (1), (1), (1)
Applications (5), (2)
Epitopes (2), (1)
Beacon