Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487276

Protein Kinase C, beta (PRKCB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PKC-beta, PKCB, PRKCB1, PRKCB2, Pkcb, Prkcb1, Prkcb2, PKC-Beta, A130082F03Rik, PKC, PKC-B, Prkcb, prkcb1, zgc:63591
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487276
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1
Sequence CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYS SPTFCDHCGS
Characteristics This is a rabbit polyclonal antibody against PRKCB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRKCB1
Background Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
Molecular Weight 77kDa
Gene ID 5579
NCBI Accession NP_002729, NM_002738
UniProt P05771
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRKCB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tatematsu, Yoshimoto, Okajima et al.: "Identification of ubiquitin ligase activity of RBCK1 and its inhibition by splice variant RBCK2 and protein kinase Cbeta." in: The Journal of biological chemistry, Vol. 283, Issue 17, pp. 11575-85, 2008 (PubMed).

Alternatives for antigen "Protein Kinase C, beta (PRKCB)", type "Antibodies"
Hosts (116), (5), (4), (4)
Reactivities (103), (75), (65), (7), (7), (4), (1), (1), (1), (1), (1)
Applications (105), (63), (26), (23), (20), (16), (8), (5), (5), (3), (2), (2), (1), (1), (1)
Conjugates (6), (6), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (19), (13), (12), (7), (7), (6), (6), (5), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon