Protein Kinase C, beta (PRKCB) (N-Term) antibody

Details for Product No. ABIN487276
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PKC-beta, PKCB, PRKCB1, PRKCB2, Pkcb, Prkcb1, Prkcb2, PKC-Beta, A130082F03Rik, PKC, PKC-B, Prkcb, prkcb1, zgc:63591
Epitope
N-Term
(29), (14), (12), (10), (9), (8), (8), (6), (6), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(124), (78), (73), (7), (5), (3), (1), (1), (1)
Host
Rabbit
(140), (8), (5), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(9), (9), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(132), (81), (45), (29), (20), (15), (15), (14), (6), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN487276
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PRKCB1
Sequence CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYS SPTFCDHCGS
Predicted Reactivity Zebrafish, Rat (Rattus), Dog (Canine), Rabbit, Guinea Pig, Cow (Bovine), Human, Mouse (Murine), Horse (Equine)
Characteristics This is a rabbit polyclonal antibody against PRKCB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRKCB1
Background Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
Molecular Weight 77 kDa
Gene ID 5579
NCBI Accession NM_002738, NP_002729
UniProt P05771
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 673 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein Kinase C, beta (PRKCB) (N-Term) antibody WB Suggested Anti-PRKCB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate
Background publications Tatematsu, Yoshimoto, Okajima et al.: "Identification of ubiquitin ligase activity of RBCK1 and its inhibition by splice variant RBCK2 and protein kinase Cbeta." in: The Journal of biological chemistry, Vol. 283, Issue 17, pp. 11575-85, 2008 (PubMed).

Hosts (140), (8), (5), (4)
Reactivities (124), (78), (73), (7), (5), (3), (1), (1), (1)
Applications (132), (81), (45), (29), (20), (15), (15), (14), (6), (3), (1), (1), (1)
Conjugates (9), (9), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (29), (14), (12), (10), (9), (8), (8), (6), (6), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top