CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1) (N-Term) antibody

Details for Product No. ABIN487282
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C20orf34, C42, CGI-05, HSPC167, 2310066P17Rik, cdk5rap1, MGC154823
Epitope
N-Term
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(22), (16), (14), (12), (12), (12), (12)
Host
Rabbit
(24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (10), (8), (5), (5), (1)
Pubmed 1 reference available
Catalog no. ABIN487282
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CDK5RAP1
Sequence MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLR TSNLQEADVI
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Dog : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against CDK5RAP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CDK5RAP1
Background Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in
Molecular Weight 55 kDa
Gene ID 51654
NCBI Accession NM_016082, NP_057166
UniProt Q96SZ6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 497 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1) (N-Term) antibody WB Suggested Anti-CDK5RAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (24)
Reactivities (22), (16), (14), (12), (12), (12), (12)
Applications (12), (10), (8), (5), (5), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
back to top