FLJ20433 (N-Term) antibody

Details for Product No. ABIN487287
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
Reactivity
Human
Host
Rabbit
Clonality
Polyclonal
Application
Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN487287
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ20433
Sequence MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWP WQVSLHFDHN
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against FLJ20433. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The specific function of FLJ20433 is not yet known.
Molecular Weight 83 kDa
Gene ID 54932
NCBI Accession NM_017820, NP_060290
UniProt Q8N9H8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 758 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ20433 (N-Term) antibody WB Suggested Anti-FLJ20433 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

back to top