ALDH1B1 antibody (N-Term)

Catalog No. ABIN4886450

Product Details anti-ALDH1B1 Antibody

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Binding Specificity: AA 116-156, N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: RVYLASLETL DNGKPFQESY ALDLDEVIKV YRYFAGWADK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 1 family member B1
Protein Name: Aldehyde dehydrogenase X, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ALDH1B1

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Alternative Name: ALDH1B1 (ALDH1B1 Products)

Synonyms: ALDH5 antibody, ALDHX antibody, rf2d antibody, 2700007F14Rik antibody, aldehyde dehydrogenase 1 family member B1 antibody, aldehyde dehydrogenase 5 antibody, aldehyde dehydrogenase 1 family, member B1 antibody, aldehyde dehydrogenase 3B1 antibody, hypothetical protein antibody, ALDH1B1 antibody, aldh5 antibody, Aldh1b1 antibody, MCYG_01035 antibody, MGYG_00956 antibody, PGTG_20239 antibody

Background: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Synonyms: Acetaldehyde dehydrogenase 5 | Aldehyde dehydrogenase X | Aldh1b1 | ALDH5 | ALDHX | P30837

Gene ID: 219

UniProt: P30837