APRT antibody (N-Term)

Catalog No. ABIN4886471

Product Details anti-APRT Antibody

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Binding Specificity: AA 5-49, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APRT antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.

Sequence: ELQLVEQRIR SFPDFPTPGV VFRDISPVLK DPASFRAAIG LLARH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.
Gene Name: adenine phosphoribosyltransferase
Protein Name: Adenine phosphoribosyltransferase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for APRT

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Alternative Name: APRT (APRT Products)

Synonyms: Tb07.43M14.200 antibody, Tb07.43M14.180 antibody, C85684 antibody, AMP antibody, APRTD antibody, adenine phosphoribosyltransferase antibody, adenine phosphoribosyl transferase antibody, CND05020 antibody, Tb927.7.1790 antibody, Tb927.7.1780 antibody, Arnit_0941 antibody, Saut_1231 antibody, Fbal_1180 antibody, PH_RS07970 antibody, PF_RS08760 antibody, PAB_RS02560 antibody, Aprt antibody, APRT antibody

Background: Adenine phosphoribosyltransferase (APRTase) is an enzyme encoded by the APRT gene, found in humans on chromosome 16. It belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: AMP | AMP diphosphorylase | AMP pyrophosphorylase | APRT | APRTD | Transphosphoribosidase | P07741

Gene ID: 353

UniProt: P07741

Pathways: Ribonucleoside Biosynthetic Process