Cnpase antibody (Middle Region)

Catalog No. ABIN4886542

Product Details anti-Cnpase Antibody

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Binding Specificity: AA 142-178, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cnpase antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.

Sequence: QYQVVLVEPK TAWRLDCAQL KEKNQWQLSA DDLKKLK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: 2',3'-cyclic nucleotide 3' phosphodiesterase
Protein Name: 2',3'-cyclic-nucleotide 3'-phosphodiesterase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Cnpase antibody (ABIN4886542)

Cai, Ma, Li, Tian, Li: "Catalpol Protects Pre-Myelinating Oligodendrocytes against Ischemia-induced Oxidative Injury through ERK1/2 Signaling Pathway." in: International journal of biological sciences, Vol. 12, Issue 12, pp. 1415-1426, (2017) (PubMed).

Target Details for Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Alternative Name: CNP (CNP Products)

Synonyms: CNP1 antibody, CNPase antibody, Cnp-1 antibody, Cnp1 antibody, CNPF antibody, CNPI antibody, CNPII antibody, CNP antibody, DKFZp469F1421 antibody, cnpl antibody, fd21d08 antibody, fi37a10 antibody, rich antibody, sb:cb662 antibody, si:ch73-158e11.4 antibody, wu:fd21d08 antibody, wu:fd44a05 antibody, wu:fi35d08 antibody, wu:fi37a10 antibody, cnp antibody, 2',3'-cyclic nucleotide 3' phosphodiesterase antibody, CNP antibody, Cnp antibody, cnp antibody, cnp.L antibody

Background: 2',3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2',3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.

Synonyms: CNP 1 | CNP1 | CNP | CNPase | P09543

Gene ID: 1267

UniProt: P09543