DDAH1 antibody (C-Term)

Catalog No. ABIN4886560

Product Details anti-DDAH1 Antibody

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Binding Specificity: AA 195-226, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDAH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: QKALKIMQQM SDHRYDKLTV PDDIAANCIY LN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dimethylarginine dimethylaminohydrolase 1
Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DDAH1

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Alternative Name: DDAH1 (DDAH1 Products)

Synonyms: DDAH antibody, 2410006N07Rik antibody, 2510015N06Rik antibody, AI987801 antibody, AW050362 antibody, DDAH1 antibody, wu:fc30c11 antibody, zgc:85829 antibody, dimethylarginine dimethylaminohydrolase 1 antibody, dimethylarginine dimethylaminohydrolase 1 L homeolog antibody, DDAH1 antibody, Ddah1 antibody, ddah1.L antibody, ddah1 antibody

Background: DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.

Synonyms: DDAH 1 | DDAH1 | DDAH | Dimethylargininase-1 | Dimethylargininase 1 | O94760

Gene ID: 23576

UniProt: O94760