Emerin antibody (N-Term)

Catalog No. ABIN4886569

Product Details anti-Emerin Antibody

Target: Emerin (EMD)

Binding Specificity: AA 1-48, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Emerin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: emerin
Protein Name: Emerin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Emerin

Target: Emerin (EMD)

Alternative Name: EMD (EMD Products)

Synonyms: fj58f01 antibody, wu:fj58f01 antibody, EMD antibody, Bocks antibody, Bocksbeutel antibody, CG9424 antibody, Dmel\\CG9424 antibody, emerin antibody, emd antibody, xemd1 antibody, xemerin2 antibody, xemd2 antibody, xemerin1 antibody, EDMD antibody, LEMD5 antibody, STA antibody, AW550900 antibody, Sta antibody, emerin antibody, emerin (Emery-Dreifuss muscular dystrophy) antibody, bocksbeutel antibody, emerin L homeolog antibody, emerin S homeolog antibody, EMD antibody, emd antibody, bocks antibody, emd.L antibody, emd.S antibody, Emd antibody

Background: Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery-Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.

Synonyms: EDMD | Emd | Emerin | LEMD5 | STA | P50402

Gene ID: 2010

UniProt: P50402