FGA antibody (C-Term)

Catalog No. ABIN4886578

Product Details anti-FGA Antibody

Target: FGA (Fibrinogen alpha Chain (FGA))

Binding Specificity: AA 687-727, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGA antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Fibrinogen alpha chain(FGA) detection. Tested with WB in Human,Rat.

Sequence: RTWQDYKRGF GSLNDEGEGE FWLGNDYLHL LTQRGSVLRV E

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Fibrinogen alpha chain(FGA) detection. Tested with WB in Human,Rat.
Gene Name: fibrinogen alpha chain
Protein Name: Fibrinogen alpha chain

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FGA

Target: FGA (Fibrinogen alpha Chain (FGA))

Alternative Name: FGA (FGA Products)

Synonyms: Fib2 antibody, ENSMUSG00000059807 antibody, Fib antibody, Ac1873 antibody, Fba5e antibody, fibrinogen alpha chain antibody, FGA antibody, Fga antibody, LOC698244 antibody

Background: Fibrinogen alpha chain is a protein that in humans is encoded by the FGA gene. This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.

Synonyms: Ac1873 | Fba5e | FGA | Fibrinopeptide A | Fib2 | P02671

Gene ID: 2243

UniProt: P02671