ITLN1/Omentin antibody (N-Term)

Catalog No. ABIN4886644

Product Details anti-ITLN1/Omentin Antibody

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Binding Specificity: AA 19-59, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITLN1/Omentin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.

Sequence: TDEANTYFKE WTCSSSPSLP RSCKEIKDEC PSAFDGLYFL R

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.
Gene Name: intelectin 1
Protein Name: Intelectin-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ITLN1/Omentin

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Alternative Name: ITLN1 (ITLN1 Products)

Synonyms: IntL antibody, Itln antibody, Itln2 antibody, Itln5 antibody, Itlna antibody, Lfr antibody, HL-1 antibody, HL1 antibody, INTL antibody, ITLN antibody, LFR antibody, hIntL antibody, omentin antibody, LfR antibody, Xeel antibody, hl-1 antibody, hl1 antibody, intl antibody, itln antibody, itln1 antibody, lfr antibody, xeel antibody, INTL1 antibody, zgc:153267 antibody, intelectin 1 (galactofuranose binding) antibody, intelectin 1 antibody, intelectin 1 L homeolog antibody, Itln1 antibody, ITLN1 antibody, itln1.L antibody, itln1 antibody

Background: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

Synonyms: Endothelial lectin HL 1 | Endothelial lectin HL-1 | hIntL | HL1 | HL 1 | Intelectin | Intelectin-1 | Intelectin 1 | INTL | ITLN | ITLN-1 | ITLN1 | LFR | Omentin | Q8WWA0

Gene ID: 55600