KDM5B antibody (Middle Region)

Catalog No. ABIN4886648

Product Details anti-KDM5B Antibody

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Binding Specificity: AA 641-685, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KDM5B antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.

Sequence: DVLDVVVAST VQKDMAIMIE DEKALRETVR KLGVIDSERM DFE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lysine demethylase 5B
Protein Name: Lysine-specific demethylase 5B

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for KDM5B

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Alternative Name: KDM5B (KDM5B Products)

Background: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

Synonyms: CT31 | JARID1B | Kdm5b | PLU-1 | PLU1 | PPP1R98 | PUT1 | RBBP2H1A | RBP2-H1 | Q9UGL1

Gene ID: 10765

Pathways: Warburg Effect